Aotea WellnessAotea WellnessAotea Wellness

Me Today Immune 60 vege capsules

Excl. GST

$34.70

Shipping calculated at checkout.
SKU: 1918-1152660N/A
Out of stock
Parcels normally take 1-3 business days to arrive within New Zealand or 7-14 business days to arrive in other destinations, depending on where you are located.

*During the holiday seasons, we kindly ask for your understanding as shipping and fulfillment times may be extended.* hoursminutes

american expressjcbapple paymasterpaypalvisaalipaywechatpay
  • Supports immune function
  • Strengthens the body's defences
  • Provides antioxidant support

Me Today Immune Complex is your premium quality formula based on scientific and traditional evidence with specifically chosen ingredients to support your immune function. Echinacea supports the body's immune defences against winter ills and chills. Vitamin C is an antioxidant which helps reduce free radicals formed in the body. Unlocking your best tomorrow.

Adults take: 1 vege cap daily with food or as directed by your healthcare professional.

Each tablet contains:

Echinacea (Echinacea Purpurea) ext. equiv. to dry root 1500mg
Vitamin C (Ascorbic Acid) 250mg
Olive Leaf (Olea Europaea) ext. equiv. to dry leaf 750mg
Equiv. Oleuropein 25mg
Citrus Bioflavonoid Extract 25mg
Zinc Amino Acid Chelate 37.5mg
Equiv. Zinc 7.5mg
Vitamin D3 (Cholecalciferol 12.5mcg) 500IU
Calcium hydrogen phosphate dihydrate
Magnesium stearate
Colloidal anhydrous silica
Also contains: 100% Hypromellose.

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping

Me Today Immune 60 vege capsules

$34.70