Aotea WellnessAotea WellnessAotea Wellness
Sold out

Hauora Colostrum Vanilla 37500mg/KG Gift Pack

Excl. GST

$382.26 $285.13

Shipping calculated at checkout.
SKU: 1823-COLO00212G1N/A

Notify me when this product is available:

american expressjcbapple paymasterpaypalvisaalipaywechatpay

Colostrum is a pre-milk fluid produced by mammals during the first 12-24 hours after giving birth, and contains immune supporting properties. These chewable colostrum tablets contain growth factors that nutritionally support the body's digestive and immune systems.

  • Contains protein, vitamins, minerals and immune enhancing factors
  • Helps prevent infection
  • Improves the performance of athletes through improved muscle power and endurance and reduced recovery time.
Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return To Shop

Add Order Note Edit Order Note
Estimate Shipping

Estimate Shipping